Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam

Cá heo Ông Sư (Orcaella brevirostris Gray, 1866) còn có tên là cá heo

Irrawaddy, cá nược Minh Hải là một loài động vật có vú thuộc họ cá heo

Delphinidae. Đánh giá chung tình trạng của loài cá heo này theo Danh lục Đỏ IUCN,

cá heo Ông Sư được xếp vào bậc sẽ nguy cấp (VU - Vulnerable) và loài này được bảo

tồn ở Việt Nam theo Quyết định số 82/2008/QĐ-BNN của Bộ Nông nghiệp và Phát

triển Nông thôn.

Tuy nhiên, ở Việt Nam việc nghiên cứu về động vật biển nói chung trong đó

có loài cá heo Ông Sư vẫn còn rất ít các nghiên cứu. Bên cạnh đó kết quả nghiên cứu

về đặc điểm hình thái chưa đủ để định loại chính xác và đánh giá mối quan hệ di

truyền giữa quần thể cá heo Ông Sư Việt Nam với các quần thể cá heo Ông Sư khác.

Các tư liệu nghiên cứu di truyền loài cá heo này cũng không có nhiều [2]. Vì vậy,

nghiên cứu về đặc điểm hình thái kết hợp với phương pháp giám định phân tử trong

định loại và đánh giá mối quan hệ di truyền giữa quần thể cá heo Ông Sư Việt Nam

với các quần thể cá heo Ông Sư khác là cần thiết và có ý nghĩa khoa học.

Trong nghiên cứu này, nhóm tác giả sử dụng phương pháp sinh học phân tử

giải trình tự gen cytochrome b (cytb) và xác định mối quan hệ phả hệ của loài cá heo

Ông Sư tại vùng biển Kiên Giang, Việt nam

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 1

Trang 1

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 2

Trang 2

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 3

Trang 3

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 4

Trang 4

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 5

Trang 5

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 6

Trang 6

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 7

Trang 7

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam trang 8

Trang 8

pdf 8 trang minhkhanh 3200
Bạn đang xem tài liệu "Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam", để tải tài liệu gốc về máy hãy click vào nút Download ở trên

Tóm tắt nội dung tài liệu: Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam

Xác định trình tự gen mã hóa cytochrome B của hệ gen TY thể và mối quan hệ di truyền của loài cá heo ông sư (orcaella brevirostris gray, 1866) vùng biển Kiên giang, Việt Nam
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 111 
XÁC ĐỊNH TRÌNH TỰ GEN MÃ HÓA Cytochrome b 
CỦA HỆ GEN TY THỂ VÀ MỐI QUAN HỆ DI TRUYỀN CỦA 
LOÀI CÁ HEO ÔNG SƯ (Orcaella brevirostris Gray, 1866) 
VÙNG BIỂN KIÊN GIANG, VIỆT NAM 
CÙ NGUYÊN ĐỊNH (1), NGUYỄN THỊ BÍCH NGA (2), NGUYỄN THỊ NGA (3), 
TRẦN LINH THƯỚC (4), BÙI LAI (5) 
1. ĐẶT VẤN ĐỀ 
Cá heo Ông Sư (Orcaella brevirostris Gray, 1866) còn có tên là cá heo 
Irrawaddy, cá nược Minh Hải là một loài động vật có vú thuộc họ cá heo 
Delphinidae. Đánh giá chung tình trạng của loài cá heo này theo Danh lục Đỏ IUCN, 
cá heo Ông Sư được xếp vào bậc sẽ nguy cấp (VU - Vulnerable) và loài này được bảo 
tồn ở Việt Nam theo Quyết định số 82/2008/QĐ-BNN của Bộ Nông nghiệp và Phát 
triển Nông thôn. 
Tuy nhiên, ở Việt Nam việc nghiên cứu về động vật biển nói chung trong đó 
có loài cá heo Ông Sư vẫn còn rất ít các nghiên cứu. Bên cạnh đó kết quả nghiên cứu 
về đặc điểm hình thái chưa đủ để định loại chính xác và đánh giá mối quan hệ di 
truyền giữa quần thể cá heo Ông Sư Việt Nam với các quần thể cá heo Ông Sư khác. 
Các tư liệu nghiên cứu di truyền loài cá heo này cũng không có nhiều [2]. Vì vậy, 
nghiên cứu về đặc điểm hình thái kết hợp với phương pháp giám định phân tử trong 
định loại và đánh giá mối quan hệ di truyền giữa quần thể cá heo Ông Sư Việt Nam 
với các quần thể cá heo Ông Sư khác là cần thiết và có ý nghĩa khoa học. 
Trong nghiên cứu này, nhóm tác giả sử dụng phương pháp sinh học phân tử 
giải trình tự gen cytochrome b (cytb) và xác định mối quan hệ phả hệ của loài cá heo 
Ông Sư tại vùng biển Kiên Giang, Việt Nam. 
2. ĐỐI TƯỢNG VÀ PHƯƠNG PHÁP NGHIÊN CỨU 
2.1. Đối tượng nghiên cứu 
Cá heo Ông Sư được nuôi dưỡng tại Câu lạc bộ cá heo Vinpearl - Nha Trang. 
Đây là loài cá heo thu nhận tại vùng biển Kiên Giang - Việt Nam đã được thuần 
dưỡng. Ký hiệu 02 mẫu cá heo là OBRE1-VN và OBRE2-VN. 
Phương pháp lấy mẫu: Lấy mẫu máu toàn phần của cá cho vào ống có chất 
chống đông, bảo quản trong hộp xốp có đá để vận chuyển về tách DNA tổng số. 
2.2. Phương pháp tách chiết DNA tổng số 
DNA tổng số được tách theo hướng dẫn của nhà sản xuất. Sử dụng bộ kit 
“Qiagen Genomic DNA Extraction Kit” của hãng QIAGEN Inc. (USA-Mỹ) để tách 
DNA tổng số. 
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 112
2.3. Phương pháp PCR thu nhận vùng gen đích 
Gen cytochrome b của hệ gen ty thể cá heo Ông Sư được lựa chọn để thu nhận 
gen bằng phương pháp PCR và giải trình tự, sau đó sử dụng chuỗi nucleotide của 
gen cytochrome b đã được giải trình tự để phân tích và so sánh với các chuỗi gen đã 
công bố trên Ngân hàng gen (Gen Bank). 
Mồi thực hiện PCR được thiết kế dựa trên trình tự bảo tồn của gen cytochrome b. 
Cặp mồi được sử dụng có trình tự trong bảng 1. 
Bảng 1. Trình tự các mồi thu nhận gen cytochrome b 
TT Tên mồi (primer) Trình tự mồi thiết kế 
1 OBREF 5’-CAC ATC CCA TAG CAC CAC CC-3’ 
2 OBRER 5’-AAT GGG GTC CTC CTT TTC GG-3’ 
Gen cytochrome b có kích thước khoảng 1.200 nucleotide (base pair - bp). 
Thực hiện phản ứng PCR với DNA tổng số thu nhận làm khuôn, sử dụng cặp 
mồi OBREF - OBRER để nhân đoạn gen đích bằng bộ kit AccuPower®ProFi Taq 
PCR Premix do hãng BIONEER (Hàn Quốc) cung cấp. Thành phần phản ứng PCR 
gồm: Khuôn DNA tổng số: 2 μl; Mồi xuôi (10pmol/μl): 2 μl; Mồi ngược 
(10pmol/μl): 2 μl; DMSO: 2 μl; Nước tinh khiết: 42 μl. Tổng thể tích là 50 μl. Chu 
trình nhiệt thực hiện PCR gồm: 1 chu kỳ 94oC - 5 phút; 35 chu kỳ 94oC - 30 giây; 
52oC - 30 giây; 68oC - 7 phút; giai đoạn tổng hợp chuỗi: 72oC - 10 phút; Sản phẩm 
được bảo quản ở 4oC cho đến khi sử dụng. 
Điện di trên thạch agarose 1% để kiểm tra sản phẩm PCR và tiến hành tinh 
sạch sản phẩm PCR để loại bỏ các thành phần phụ không mong muốn chỉ giữ lại 
DNA tinh khiết. Tinh sạch sản phẩm bằng bộ QIAquick PCR purification kit 
(Qiagen Inc.). Sản phẩm PCR sau khi tinh sạch sẽ được dòng hóa vào vector tách 
dòng pCR2.1TOPO (hãng Invitrogen - Mỹ) để thu nhận DNA tái tổ hợp và gửi đọc 
trình tự tại công ty Macrogen (Hàn Quốc). 
2.4. Phương pháp giải trình tự 
Cặp mồi dùng để giải trình tự DNA plasmid tái tổ hợp gồm: 
- Mồi xuôi (M13F) : 5’-GTAAAACGACGGCCAG-3’ hoặc 
- Mồi ngược (M13R) : 5’-CAGGAAACAGCATTGAC-3’ 
Chuỗi DNA sản phẩm được xác định trình tự theo chiều 5’→ 3’ và dùng thuốc 
nhuộm huỳnh quang (fluorescent dye) để đánh dấu, sử dụng thạch polyacrylamide 
và quét tia lazer dọc theo chuỗi để đọc trình tự, phân tích tự động bằng máy với các 
chương trình phần mềm tin - sinh học. 
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 113 
2.5. Phương pháp phân tích và xử lý số liệu 
Sau khi giải trình tự các chuỗi nucleotide được thu nhận và xử lý bằng các 
phần mềm Chromas LITE v2.01, so sánh đối chiếu và xử lý số liệu các chuỗi từ 
nghiên cứu và từ Ngân hàng gen (GenBank) bằng chương trình GENEDOC2.7 
( [3]. 
Sử dụng chương trình MEGA (Molecular Evolutionary Genetics Analysis) để 
xây dựng cây phả hệ. Các phân tích được thực hiện dựa trên tập hợp các trình tự gen 
cytochrome b trong hệ gen ty thể (mtDNA) của một số loài cá heo đã công bố trong 
Ngân hàng gen (GenBank). Phân tích được tiến hành dựa trên thuật toán Neightbour 
joining (NJ) bằng phần mềm MEGA6.06 [4]. 
3. KẾT QUẢ VÀ THẢO LUẬN 
3.1. Thu nhận gen cytochrome b của các mẫu nghiên cứu 
Thực hiện phản ứng PCR thu nhận đoạn DNA với cặp mồi đặc hiệu của gen 
cytochrome b có độ dài dự kiến khoảng 1,2 kb (hình 1). 
Hình 1. Hình ảnh điện di kiểm tra sản phẩm PCR gen cytochrome b của hai mẫu cá 
heo Ông Sư (ký hiệu OBRE1-VN và OBRE2-VN) trên thạch agarose 1%. 
Ghi chú: M: Marker Lamda cắt bằng enzyme HindIII; Đ/C(-): mẫu đối chứng âm. 
Kết quả ở hình 1 cho thấy hai mẫu OBRE1-VN và OBRE2-VN trong nghiên 
cứu đã được tách DNA tổng số, phản ứng PCR thu nhận gen cytochrome b đã được 
thực hiện thành công, sản phẩm PCR có độ dài khoảng 1,2 k ... ...................................................................... : 168 
Satt-z0002 : .................................................................................... : 168 
Satt-z0002 : .................................................................................... : 167 
Satt-z0011 : .................................................................................... : 168 
Satt-z0011 : .................................................................................... : 168 
Satt-z0012 : ..T................................................................................. : 168 
Satt-z0016 : ...........................................................................-........ : 165 
Satt-z0024 : .................................................................................... : 168 
Satt-z0038 : .................................................................................... : 168 
 * 180 * 200 * 220 * 240 * 
OBRE1-VN-c : SVDKATLTRFFAFYFILPFIITALVIVHLLFLHETGSNNPTGIPSNMDMIPFHPYHTFKDILGALLLILVLLTLTLFTPDLLGD : 252 
OBRE2-VN-c : .............H...................................................................... : 252 
OBRE-KG-VN : .............H...................................................................... : 252 
OBRE-Laos- : .............H...................................................................... : 252 
OBRE-SWFSC : .............H...................................................................... : 252 
Ohei02-DK- : .............H...........T.......................................................... : 252 
Ohei06-DK- : .............H...........T.......................................................... : 252 
Ohei08-DK- : .............H...........T..............................................M........... : 252 
Ohei22-DK- : .............H...........T..............................................M........... : 252 
Ohei28-DK- : .............H...........T..............................................M........... : 252 
Oorc-72-US : .............H..........TA...............................I..T........T..A....A...... : 252 
Oorc-96-US : .............H..........TA...............................I..T........T..A....A...... : 252 
Oorc-97-US : .............H..........TA...............................I..T........T..A....A...... : 252 
Oorc-111-U : .............H..........TA...............................I..T........T..A....A...... : 252 
Oorc-129-U : .............H..........TA...............................I..T........T..A....A...... : 252 
Oorc-ENAC2 : .............H..........TA...............................I..T........T..A....A...... : 252 
Satt-z0000 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0002 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0002 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0002 : .............H..........AA.............................Y.I...........T..A........... : 251 
Satt-z0011 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0011 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0012 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0016 : .............H..........AA.............................Y.I...........T..A........... : 249 
Satt-z0024 : .............H..........AA.............................Y.I...........T..A........... : 252 
Satt-z0038 : .............H..........AA.............................Y.I...........T..A........... : 252 
 260 * 280 * 300 * 320 * 
OBRE1-VN-c : PDNYTPANPLSTPAHIKPEWYFLFAYAILRSIPNKLGGVLALLLSILILIFIPMLQTSKQRSMMFRPFSQLLFWTLIADLLTLT : 336 
OBRE2-VN-c : .................................................................................... : 336 
OBRE-KG-VN : .................................................................................... : 336 
OBRE-Laos- : .................................................................................... : 336 
OBRE-SWFSC : .................................................................................... : 336 
Ohei02-DK- : .................................................................................... : 336 
Ohei06-DK- : .................................................................................... : 336 
Ohei08-DK- : .................................................................................... : 336 
Ohei22-DK- : .................................................................................... : 336 
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 116
Ohei28-DK- : .................................................................................... : 336 
Oorc-72-US : ...............................V.................................................... : 336 
Oorc-96-US : ...............................V.................................................... : 336 
Oorc-97-US : ...............................V.................................................... : 336 
Oorc-111-U : ...............................V.................................................... : 336 
Oorc-129-U : ...............................V.................................................... : 336 
Oorc-ENAC2 : ...............................V.................................................... : 336 
Satt-z0000 : ...............................................V.................................... : 336 
Satt-z0002 : ...............................................V.................................... : 336 
Satt-z0002 : ...............................................V.................................... : 336 
Satt-z0002 : ...............................................V.................................... : 335 
Satt-z0011 : ...............................................V.................................... : 336 
Satt-z0011 : ...............................................V.................................... : 336 
Satt-z0012 : ...............................................V.................................... : 336 
Satt-z0016 : ...............................................V.................................... : 333 
Satt-z0024 : ...............................................V.................................... : 336 
Satt-z0038 : ...............................................V.................................... : 336 
 340 * 360 * 380 
OBRE1-VN-c : WIGGQPVEHPYIIVGQLASILYFLLILVLMPTVSLIENKLLKW- : 379 
OBRE2-VN-c : ...........................................- : 379 
OBRE-KG-VN : ...........................................- : 379 
OBRE-Laos- : ...S.......................................- : 379 
OBRE-SWFSC : ...........................................- : 379 
Ohei02-DK- : ...........................................- : 379 
Ohei06-DK- : ...........................................- : 379 
Ohei08-DK- : ...........................................- : 379 
Ohei22-DK- : ...........................................- : 379 
Ohei28-DK- : ...........................................- : 379 
Oorc-72-US : ................................I..........- : 379 
Oorc-96-US : ................................I..........- : 379 
Oorc-97-US : ................................I..........- : 379 
Oorc-111-U : ................................I..........- : 379 
Oorc-129-U : ................................I..........- : 379 
Oorc-ENAC2 : ................................I..........- : 379 
Satt-z0000 : ................................AG.........- : 379 
Satt-z0002 : ................................AG.........- : 379 
Satt-z0002 : ................................AG.........- : 379 
Satt-z0002 : ................................AG.........- : 378 
Satt-z0011 : ................................AG.........- : 379 
Satt-z0011 : ................................AG.........- : 379 
Satt-z0012 : ................................AG.........- : 379 
Satt-z0016 : ................................AG.....-...- : 375 
Satt-z0024 : ................................AG.........- : 379 
Satt-z0038 : ................................AG.........- : 379 
Hình 3. Trình tự amino acid suy diễn gen cytochrome b của OBRE1-VN và 
OBRE2-VN so sánh với các chuỗi đăng ký trong Ngân hàng gen. 
Ký hiệu (.) là biểu thị các trình tự amino acid giống nhau. Các sai khác được 
thể hiện bằng các chữ cái. 
Kết quả ở hình 3 cho thấy chuỗi gen amino acid cytochrome b trong 2 mẫu 
OBRE1-VN và OBRE2-VN có sự tương đồng rất cao (99%) so với các chuỗi gen 
cytochrome b đã công bố trong Ngân hàng gen là OBRE-KG-VN (số đăng ký: 
JQ814471), mẫu của Indonesia OBRE-SWFSC-74697-ID (số đăng ký: JF289177) 
và mẫu của Lào là OBRE-Laos (số đăng ký: AF084062). Đặc biệt trong hai mẫu 
OBRE1-VN và OBRE2-VN phát hiện có sự sai khác tại vị trí amino acid Y182H 
(Y = Tyrosine; H = Histidine). Trong đó, Tyrorine là một acid amin không cần thiết 
có thể tổng hợp được trong cơ thể mà khi thiếu chúng thì cơ thể có thể bù trừ sự thiếu 
hụt đó nhờ các quá trình tổng hợp bên trong. Còn Histidine là một acid amin cần thiết 
không thể thay thế được vì chúng không thể tự tổng hợp trong cơ thể hoặc tổng hợp 
với tốc độ không thể đáp ứng được nhu cầu của cơ thể mà chúng phải được đưa vào 
đầy đủ trong đạm thức ăn. Về vấn đề này rất lý thú cần có thêm những nghiên cứu 
sâu hơn về bản chất của các amino acid và vai trò dinh dưỡng của chúng và với số 
lượng cỡ mẫu trong nghiên cứu cũng nhiều hơn. Trong nghiên cứu này, nhóm tác giả 
còn thu thập thêm một số chuỗi của loài Orcaella heinsohni (Ohei), Orcinus orca 
(Oorc) và Stenella attenuata (Satt) đăng ký trong GenBank thuộc họ cá heo để tham 
khảo trong so sánh và phân tích trình tự nucleotide và amino acid suy diễn. 
Kết quả xây dựng cây phả hệ dựa trên trình tự nucleotide chuỗi cytochrome b 
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 117 
của 26 mẫu (bao gồm cả hai mẫu trong nghiên cứu) được trình bày ở hình 4. Kết quả 
cây phả hệ cho thấy hai mẫu OBRE1-VN và OBRE2-VN nằm trong cùng nhóm cá 
heo Ông Sư của Việt Nam (OBRE-KG-VN), Indonesia (OBRE-SWFSC-74697-ID) 
và Lào (OBRE-Laos). Như vậy, hai mẫu OBRE1-VN và OBRE2-VN đã được xác 
định chính xác thuộc loài cá heo Ông Sư (Orcaella brevirostris Gray, 1866). 
Hình 4. Cây phả hệ của OBRE1-VN và OBRE2-VN và các loài trong họ cá heo đã 
được đăng ký trong Ngân hàng gen dựa trên phân tích chuỗi nucleotide gen 
cytochrome b. Ký hiệu (♦) là các mẫu trong nghiên cứu này. 
4. KẾT LUẬN 
1. Sử dụng phương pháp sinh học phân tử so sánh, phân tích chuỗi nucleotide 
và amino acid suy diễn của gen cytochrome b. 
2. Xây dựng cây phả hệ cho thấy hai mẫu OBRE1-VN và OBRE2-VN đã được xác 
định thuộc về loài cá heo Ông Sư có tên khoa học là Orcaella brevirostris Gray, 1866. 
3. Các mẫu trong nghiên cứu có mối quan hệ phả hệ nguồn gốc gần với một số 
mẫu đã công bố trong Ngân hàng gen của Việt Nam, Indonesia và Lào. 
TÀI LIỆU THAM KHẢO 
1. Bộ Nông nghiệp và Phát triển Nông thôn, Danh mục các loài thuỷ sinh quý 
hiếm có nguy cơ tuyệt chủng ở Việt Nam cần được bảo vệ, phục hồi và phát 
triển, Quyết định số 82/2008/QĐ-BNN, 2008. 
2. LeDuc R.G., Perrin W.F., Dizon A.E., Phylogenetic relationships among the 
Delphinid cetaceans based on full cytochrome b sequences. Mar Mamm Sci 
1999, 15:619-648. 
 OBRE1-VN-cytB(1140bp)
 OBRE-KG-VN-JQ814471
 OBRE2-VN-cytB(1140bp)
 OBRE-SWFSC-74697-ID-JF289177
 OBRE-Laos-AF084062
 Ohei02-JF339980
 Ohei06-JF339981
 Ohei08-JF339978
 Ohei22-JF339979
 Ohei28-JF339977
 Oorc-96-KR180365
 Oorc-97-KR180366
 Oorc-72-KR180342
 Oorc-111-KR180312
 Oorc-129-KR180326
 Oorc-ENAC2-Spain-HQ405752
 Satt-z0011921-KX857288
 Satt-z0012046-KX857298
 Satt-z0016255-KX857317
 Satt-z0024848-KX857334
 Satt-z0000973-KX857266
 Satt-z0038287-KX857341
 Satt-z0002879-KX857280
 Satt-z0002173-KX857273
 Satt-z0002203-KX857279
 Satt-z0011361-KX857281
100
89
100
92
100
75
100
100
76
0.005
 Nghiên cứu khoa học công nghệ 
Tạp chí Khoa học và Công nghệ nhiệt đới, Số 14, 11 - 2017 118
3. Nicholas K.B., Nicholas H.B., GeneDoc: a tool for editing and annotating 
multiple sequence aglignments, Distributed by authors, 1997. 
4. Tamura K., Stecher G., Peterson D., Filipski A., Kumar S., MEGA6: Molecular 
Evolutionary Genetics Analysis Version 6.0, Mol Biol Evol, 2013, 30:2725-2729. 
5. The IUCN Red List of Threatened Species. Version 2016.3. 
 Truy cập 5/4/2017. 
SUMMARY 
DETERMINING THE MITOCHONDRIAL Cytochrome b GENE SEQUENCE 
AND THE HEREDITARY RELATIONSHIP OF IRRAWADDY DOLPHINS 
(Orcaella brevirostris Gray, 1866) IN KIEN GIANG WATERS, VIETNAM 
In this study, two samples of Irrawaddy dolphins (Orcaella brevirostris Gray, 
1866) in Kien Giang waters, Vietnam were collected. The phylogenetic tree showed 
that Irrawaddy dolphins in Vietnam had a close genetic relationship to Irrawaddy 
dolphins in Indonesia and Laos which have been registered in the Gene Bank. 
This is the latest research in Vietnam about determining the mitochondrial 
cytochrome b gene sequence and the hereditary relationship of Irrawaddy dolphin 
(Orcaella brevirostris Gray, 1866) in Kien Giang waters. This results contributed to the 
conservative research and development of this valuable and rare marine mammal species. 
Từ khóa: Cá heo Ông Sư, phả hệ, phát sinh loài, ty thể, Orcaella brevirostris, 
cytochrome b, Irrawaddy dolphin, family tree, phylogenetic, mitochondria. 
Nhận bài ngày 24 tháng 8 năm 2017 
Hoàn thiện ngày 12 tháng 10 năm 2017 
(1) Chi nhánh Phía Nam, Trung tâm Nhiệt đới Việt - Nga 
(2) Viện Công nghệ Sinh học, Viện Hàn lâm KH&CN Việt Nam 
(3) Đại học Quốc tế Hồng Bàng 
(4) Đại học Khoa học Tự nhiên - ĐHQG.HCM 
 (5) Viện Sinh học Nhiệt đới, Viện Hàn lâm KH&CN Việt Nam 

File đính kèm:

  • pdfxac_dinh_trinh_tu_gen_ma_hoa_cytochrome_b_cua_he_gen_ty_the.pdf